Lineage for d1qcva_ (1qcv A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892941Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 893109Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 893110Family g.41.5.1: Rubredoxin [57803] (4 proteins)
  6. 893119Protein Rubredoxin [57804] (6 species)
  7. 893120Species Archaeon Pyrococcus furiosus [TaxId:2261] [57809] (11 PDB entries)
    Uniprot P24297
  8. 893130Domain d1qcva_: 1qcv A: [45241]
    variant pfrd-xc4 folds without iron

Details for d1qcva_

PDB Entry: 1qcv (more details)

PDB Description: rubredoxin variant (pfrd-xc4) folds without iron
PDB Compounds: (A:) protein (rubredoxin variant pfrd-xc4)

SCOP Domain Sequences for d1qcva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcva_ g.41.5.1 (A:) Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2261]}
akwvlkitgyiydedagdpdngispgtkfeelpddwvapitgapksefekled

SCOP Domain Coordinates for d1qcva_:

Click to download the PDB-style file with coordinates for d1qcva_.
(The format of our PDB-style files is described here.)

Timeline for d1qcva_: