SCOPe 2.07: Domain d1caaa_: 1caa A:

Lineage for d1caaa_ (1caa A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.1: Rubredoxin [57803] (5 proteins)

6. Protein Rubredoxin [57804] (8 species)

7. Species Pyrococcus furiosus [TaxId:2261] [57809] (30 PDB entries)
   Uniprot P24297

8. Domain d1caaa_: 1caa A: [45239]
   complexed with fe

Details for d1caaa_

PDB Entry: 1caa, 1.8 Å

PDB Description: x-ray crystal structures of the oxidized and reduced forms of the rubredoxin from the marine hyperthermophilic archaebacterium pyrococcus furiosus

PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d1caaa_:

Sequence; same for both SEQRES and ATOM records:

>d1caaa_ g.41.5.1 (A:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]}
akwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled

Timeline for d1caaa_:

• d1caaa_ first appeared (with stable ids) in SCOP 1.55, called d1caa__
  
• d1caaa_ appears in SCOPe 2.06
  
• d1caaa_ appears in the current release, SCOPe 2.08