Lineage for d1caaa_ (1caa A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892941Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 893109Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 893110Family g.41.5.1: Rubredoxin [57803] (4 proteins)
  6. 893119Protein Rubredoxin [57804] (6 species)
  7. 893120Species Archaeon Pyrococcus furiosus [TaxId:2261] [57809] (11 PDB entries)
    Uniprot P24297
  8. 893127Domain d1caaa_: 1caa A: [45239]
    complexed with fe

Details for d1caaa_

PDB Entry: 1caa (more details), 1.8 Å

PDB Description: x-ray crystal structures of the oxidized and reduced forms of the rubredoxin from the marine hyperthermophilic archaebacterium pyrococcus furiosus
PDB Compounds: (A:) rubredoxin

SCOP Domain Sequences for d1caaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1caaa_ g.41.5.1 (A:) Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2261]}
akwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled

SCOP Domain Coordinates for d1caaa_:

Click to download the PDB-style file with coordinates for d1caaa_.
(The format of our PDB-style files is described here.)

Timeline for d1caaa_: