Lineage for d1bq8a_ (1bq8 A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41508Fold g.41: Rubredoxin-like [57769] (8 superfamilies)
  4. 41580Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 41581Family g.41.5.1: Rubredoxin [57803] (2 proteins)
  6. 41582Protein Rubredoxin [57804] (6 species)
  7. 41611Species Pyrococcus furiosus [TaxId:186497] [57809] (7 PDB entries)
  8. 41613Domain d1bq8a_: 1bq8 A: [45237]

Details for d1bq8a_

PDB Entry: 1bq8 (more details), 1.1 Å

PDB Description: rubredoxin (methionine mutant) from pyrococcus furiosus

SCOP Domain Sequences for d1bq8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bq8a_ g.41.5.1 (A:) Rubredoxin {Pyrococcus furiosus}
makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled

SCOP Domain Coordinates for d1bq8a_:

Click to download the PDB-style file with coordinates for d1bq8a_.
(The format of our PDB-style files is described here.)

Timeline for d1bq8a_: