Lineage for d1b2oa_ (1b2o A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2587435Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2587651Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2587652Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 2587661Protein Rubredoxin [57804] (8 species)
  7. 2587662Species Clostridium pasteurianum [TaxId:1501] [57808] (23 PDB entries)
    Uniprot P00268
  8. 2587685Domain d1b2oa_: 1b2o A: [45233]
    complexed with fe; mutant

Details for d1b2oa_

PDB Entry: 1b2o (more details), 1.9 Å

PDB Description: clostridium pasteurianum rubredoxin g10vg43a mutant
PDB Compounds: (A:) protein (rubredoxin)

SCOPe Domain Sequences for d1b2oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b2oa_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]}
mkkytctvcvyiynpedgdpdngvnpgtdfkdipddwvcplcavgkdqfeevee

SCOPe Domain Coordinates for d1b2oa_:

Click to download the PDB-style file with coordinates for d1b2oa_.
(The format of our PDB-style files is described here.)

Timeline for d1b2oa_: