Lineage for d1irna_ (1irn A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263118Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2263119Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 2263128Protein Rubredoxin [57804] (8 species)
  7. 2263129Species Clostridium pasteurianum [TaxId:1501] [57808] (23 PDB entries)
    Uniprot P00268
  8. 2263131Domain d1irna_: 1irn A: [45224]
    complexed with zn

Details for d1irna_

PDB Entry: 1irn (more details), 1.2 Å

PDB Description: rubredoxin (zn-substituted) at 1.2 angstroms resolution
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d1irna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1irna_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]}
mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgvgkdqfeeve

SCOPe Domain Coordinates for d1irna_:

Click to download the PDB-style file with coordinates for d1irna_.
(The format of our PDB-style files is described here.)

Timeline for d1irna_: