Lineage for d1irn__ (1irn -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41508Fold g.41: Rubredoxin-like [57769] (8 superfamilies)
  4. 41580Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 41581Family g.41.5.1: Rubredoxin [57803] (2 proteins)
  6. 41582Protein Rubredoxin [57804] (6 species)
  7. 41583Species Clostridium pasteurianum [TaxId:1501] [57808] (10 PDB entries)
  8. 41585Domain d1irn__: 1irn - [45224]

Details for d1irn__

PDB Entry: 1irn (more details), 1.2 Å

PDB Description: rubredoxin (zn-substituted) at 1.2 angstroms resolution

SCOP Domain Sequences for d1irn__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1irn__ g.41.5.1 (-) Rubredoxin {Clostridium pasteurianum}
mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgvgkdqfeeve

SCOP Domain Coordinates for d1irn__:

Click to download the PDB-style file with coordinates for d1irn__.
(The format of our PDB-style files is described here.)

Timeline for d1irn__: