Lineage for d1rdga_ (1rdg A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641212Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2641213Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 2641222Protein Rubredoxin [57804] (8 species)
  7. 2641259Species Desulfovibrio gigas [TaxId:879] [57806] (3 PDB entries)
  8. 2641261Domain d1rdga_: 1rdg A: [45221]
    complexed with fe, for

Details for d1rdga_

PDB Entry: 1rdg (more details), 1.4 Å

PDB Description: rubredoxin from desulfovibrio gigas. a molecular model of the oxidized form at 1.4 angstroms resolution
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d1rdga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rdga_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio gigas [TaxId: 879]}
mdiyvctvcgyeydpakgdpdsgikpgtkfedlpddwacpvcgaskdafekq

SCOPe Domain Coordinates for d1rdga_:

Click to download the PDB-style file with coordinates for d1rdga_.
(The format of our PDB-style files is described here.)

Timeline for d1rdga_: