![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.5: Rubredoxin-like [57802] (4 families) ![]() |
![]() | Family g.41.5.1: Rubredoxin [57803] (5 proteins) |
![]() | Protein Rubredoxin [57804] (8 species) |
![]() | Species Desulfovibrio vulgaris [TaxId:881] [57805] (8 PDB entries) |
![]() | Domain d2rdvc_: 2rdv C: [45219] complexed with fe |
PDB Entry: 2rdv (more details), 1.9 Å
SCOPe Domain Sequences for d2rdvc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rdvc_ g.41.5.1 (C:) Rubredoxin {Desulfovibrio vulgaris [TaxId: 881]} mkkyvctvcgyeydpaegdpdngvkpgtafedvpadwvcpicgapksefepa
Timeline for d2rdvc_: