SCOPe 2.02: Domain d2rdvc_: 2rdv C:

Lineage for d2rdvc_ (2rdv C:)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (3 families)

5. Family g.41.5.1: Rubredoxin [57803] (5 proteins)

6. Protein Rubredoxin [57804] (8 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [57805] (7 PDB entries)

8. Domain d2rdvc_: 2rdv C: [45219]
   complexed with fe

Details for d2rdvc_

PDB Entry: 2rdv, 1.9 Å

PDB Description: rubredoxin from desulfovibrio vulgaris miyazaki f, monoclinic crystal form

PDB Compounds: (C:) rubredoxin

SCOPe Domain Sequences for d2rdvc_:

Sequence; same for both SEQRES and ATOM records:

>d2rdvc_ g.41.5.1 (C:) Rubredoxin {Desulfovibrio vulgaris [TaxId: 881]}
mkkyvctvcgyeydpaegdpdngvkpgtafedvpadwvcpicgapksefepa

Timeline for d2rdvc_:

• d2rdvc_ first appeared (with stable ids) in SCOP 1.55
  
• d2rdvc_ appears in SCOPe 2.01
  
• d2rdvc_ appears in SCOPe 2.03
  
• d2rdvc_ appears in the current release, SCOPe 2.08