SCOPe 2.08: Domain d1qypa1: 1qyp A:5-57

Lineage for d1qypa1 (1qyp A:5-57)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families)

5. Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins)

6. Protein RBP9 subunit of RNA polymerase II [57787] (3 species)
   contains two differently decorated domains of this fold

7. Species Thermococcus celer [TaxId:2264] [57788] (1 PDB entry)

8. Domain d1qypa1: 1qyp A:5-57 [45205]
   Other proteins in same PDB: d1qypa2
   C-terminal domain
   complexed with zn

Details for d1qypa1

PDB Entry: 1qyp

PDB Description: thermococcus celer rpb9, nmr, 25 structures

PDB Compounds: (A:) RNA polymerase II

SCOPe Domain Sequences for d1qypa1:

Sequence; same for both SEQRES and ATOM records:

>d1qypa1 g.41.3.1 (A:5-57) RBP9 subunit of RNA polymerase II {Thermococcus celer [TaxId: 2264]}
eqdlktlpttkitcpkcgndtaywwemqtragdepstifykctkcghtwrsye

Timeline for d1qypa1:

• d1qypa1 first appeared (with stable ids) in SCOP 1.55, called d1qyp__
  
• d1qypa1 was called d1qypa_ in SCOPe 2.07