SCOP 1.71: Domain d2aky_2: 2aky 131-168

Lineage for d2aky_2 (2aky 131-168)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.41: Rubredoxin-like [57769] (14 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family)

5. Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)

6. Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57781] (4 PDB entries)
   contains a rudiment "zinc-finger" subdomain

8. Domain d2aky_2: 2aky 131-168 [45198]
   Other proteins in same PDB: d2aky_1
   complexed with ap5, mg

Details for d2aky_2

PDB Entry: 2aky, 1.96 Å

PDB Description: high-resolution structures of adenylate kinase from yeast ligated with inhibitor ap5a, showing the pathway of phosphoryl transfer

SCOP Domain Sequences for d2aky_2:

Sequence; same for both SEQRES and ATOM records:

>d2aky_2 g.41.2.1 (131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae)}
grlihpasgrsyhkifnppkedmkddvtgealvqrsdd

Timeline for d2aky_2:

• d2aky_2 first appeared (with stable ids) in SCOP 1.55
  
• d2aky_2 appears in SCOP 1.69
  
• d2aky_2 is called d2akya2 in SCOP 1.73
  
• d2aky_2 appears in the current release, SCOPe 2.08, called d2akya2