Lineage for d1akya2 (1aky A:131-168)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 750708Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) (S)
  5. 750709Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)
  6. 750710Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species)
  7. 750719Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57781] (4 PDB entries)
    contains a rudiment "zinc-finger" subdomain
  8. 750720Domain d1akya2: 1aky A:131-168 [45197]
    Other proteins in same PDB: d1akya1
    complexed with ap5, imd

Details for d1akya2

PDB Entry: 1aky (more details), 1.63 Å

PDB Description: high-resolution structures of adenylate kinase from yeast ligated with inhibitor ap5a, showing the pathway of phosphoryl transfer
PDB Compounds: (A:) adenylate kinase

SCOP Domain Sequences for d1akya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
grlihpasgrsyhkifnppkedmkddvtgealvqrsdd

SCOP Domain Coordinates for d1akya2:

Click to download the PDB-style file with coordinates for d1akya2.
(The format of our PDB-style files is described here.)

Timeline for d1akya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1akya1