Lineage for d1ak2_2 (1ak2 147-176)
- Root: SCOP 1.67
Class g: Small proteins [56992] (72 folds) 
Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) 
Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein) Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species) 
Species Cow (Bos taurus), mitochondrial izozyme-2 [TaxId:9913] [57780] (2 PDB entries)
contains a rudiment "zinc-finger" subdomain
Domain d1ak2_2: 1ak2 147-176 [45195]
Other proteins in same PDB: d1ak2_1
complexed with so4
Details for d1ak2_2
PDB Entry: 1ak2 (more details), 1.92 Å
PDB Description: adenylate kinase isoenzyme-2
SCOP Domain Sequences for d1ak2_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ak2_2 g.41.2.1 (147-176) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-2}
pqsgrsyheefnppkepmkdditgeplirr
SCOP Domain Coordinates for d1ak2_2:
Click to download the PDB-style file with coordinates for d1ak2_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ak2_2:
- d1ak2_2 first appeared (with stable ids) in SCOP 1.55
- d1ak2_2 appears in SCOP 1.65
- d1ak2_2 appears in SCOP 1.69
- d1ak2_2 appears in the current release, SCOPe 2.08, called d1ak2a2
View in 3D
