SCOP 1.69: Domain d2ak3b2: 2ak3 B:125-161

Lineage for d2ak3b2 (2ak3 B:125-161)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family)

5. Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)

6. Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species)

7. Species Cow (Bos taurus), mitochondrial izozyme-3 [TaxId:9913] [57779] (1 PDB entry)
   contains a rudiment "zinc-finger" subdomain

8. Domain d2ak3b2: 2ak3 B:125-161 [45194]
   Other proteins in same PDB: d2ak3a1, d2ak3b1

Details for d2ak3b2

PDB Entry: 2ak3, 1.85 Å

PDB Description: the three-dimensional structure of the complex between mitochondrial matrix adenylate kinase and its substrate amp at 1.85 angstroms resolution

SCOP Domain Sequences for d2ak3b2:

Sequence; same for both SEQRES and ATOM records:

>d2ak3b2 g.41.2.1 (B:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3}
arwihpgsgrvyniefnppktmgiddltgeplvqred

Timeline for d2ak3b2:

• d2ak3b2 first appeared (with stable ids) in SCOP 1.55
  
• d2ak3b2 appears in SCOP 1.67
  
• d2ak3b2 appears in SCOP 1.71
  
• d2ak3b2 appears in the current release, SCOPe 2.08