SCOP 1.71: Domain d1e4vb2: 1e4v B:122-156

Lineage for d1e4vb2 (1e4v B:122-156)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.41: Rubredoxin-like [57769] (14 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family)

5. Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)

6. Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species)

7. Species Escherichia coli [TaxId:562] [57778] (6 PDB entries)
   contains a rudiment form of the domain that lacks zn-binding site

8. Domain d1e4vb2: 1e4v B:122-156 [45184]
   Other proteins in same PDB: d1e4va1, d1e4vb1
   complexed with ap5; mutant

Details for d1e4vb2

PDB Entry: 1e4v, 1.85 Å

PDB Description: mutant g10v of adenylate kinase from e. coli, modified in the gly-loop

SCOP Domain Sequences for d1e4vb2:

Sequence; same for both SEQRES and ATOM records:

>d1e4vb2 g.41.2.1 (B:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli}
grrvhapsgrvyhvkfnppkvegkddvtgeelttr

Timeline for d1e4vb2:

• d1e4vb2 first appeared (with stable ids) in SCOP 1.55
  
• d1e4vb2 appears in SCOP 1.69
  
• d1e4vb2 appears in SCOP 1.73
  
• d1e4vb2 appears in the current release, SCOPe 2.08