SCOP 1.57: Domain d1hnxn_: 1hnx N:

Lineage for d1hnxn_ (1hnx N:)

1. Root: SCOP 1.57

2. Class g: Small proteins [56992] (56 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (1 species)

7. Species Thermus thermophilus [TaxId:274] [57754] (10 PDB entries)

8. Domain d1hnxn_: 1hnx N: [45158]
   Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_

Details for d1hnxn_

PDB Entry: 1hnx, 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin

SCOP Domain Sequences for d1hnxn_:

Sequence; same for both SEQRES and ATOM records:

>d1hnxn_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d1hnxn_:

• d1hnxn_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnxn_ appears in SCOP 1.59
  
• d1hnxn_ appears in the current release, SCOPe 2.08