Lineage for d1hnxn_ (1hnx N:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41378Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
  4. 41379Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) (S)
  5. 41469Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 41470Protein Ribosomal protein S14 [57753] (1 species)
  7. 41471Species Thermus thermophilus [TaxId:274] [57754] (6 PDB entries)
  8. 41477Domain d1hnxn_: 1hnx N: [45158]
    Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_

Details for d1hnxn_

PDB Entry: 1hnx (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin

SCOP Domain Sequences for d1hnxn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnxn_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOP Domain Coordinates for d1hnxn_:

Click to download the PDB-style file with coordinates for d1hnxn_.
(The format of our PDB-style files is described here.)

Timeline for d1hnxn_: