Lineage for d1hnwn_ (1hnw N:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 90358Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
  4. 90359Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) (S)
  5. 90452Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 90453Protein Ribosomal protein S14 [57753] (1 species)
  7. 90454Species Thermus thermophilus [TaxId:274] [57754] (10 PDB entries)
  8. 90460Domain d1hnwn_: 1hnw N: [45157]
    Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_

Details for d1hnwn_

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

SCOP Domain Sequences for d1hnwn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnwn_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOP Domain Coordinates for d1hnwn_:

Click to download the PDB-style file with coordinates for d1hnwn_.
(The format of our PDB-style files is described here.)

Timeline for d1hnwn_: