Lineage for d1hnwn_ (1hnw N:)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) 
Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein) Protein Ribosomal protein S14 [57753] (1 species) Species Thermus thermophilus [TaxId:274] [57754] (6 PDB entries) 
Domain d1hnwn_: 1hnw N: [45157]
Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_
Details for d1hnwn_
PDB Entry: 1hnw (more details), 3.4 Å
PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
SCOP Domain Sequences for d1hnwn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnwn_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
SCOP Domain Coordinates for d1hnwn_:
Click to download the PDB-style file with coordinates for d1hnwn_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hnwn_:
- d1hnwn_ appears in SCOP 1.57
- d1hnwn_ appears in the current release, SCOPe 2.08
View in 3D
