Lineage for d1hnzn_ (1hnz N:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41378Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
  4. 41379Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) (S)
  5. 41469Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 41470Protein Ribosomal protein S14 [57753] (1 species)
  7. 41471Species Thermus thermophilus [TaxId:274] [57754] (6 PDB entries)
  8. 41474Domain d1hnzn_: 1hnz N: [45156]
    Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_

Details for d1hnzn_

PDB Entry: 1hnz (more details), 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b

SCOP Domain Sequences for d1hnzn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnzn_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOP Domain Coordinates for d1hnzn_:

Click to download the PDB-style file with coordinates for d1hnzn_.
(The format of our PDB-style files is described here.)

Timeline for d1hnzn_: