Lineage for d1hr0n_ (1hr0 N:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 344032Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 344033Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (9 families) (S)
  5. 344163Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 344164Protein Ribosomal protein S14 [57753] (1 species)
  7. 344165Species Thermus thermophilus [TaxId:274] [57754] (14 PDB entries)
  8. 344168Domain d1hr0n_: 1hr0 N: [45155]
    Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_
    complexed with mg, zn

Details for d1hr0n_

PDB Entry: 1hr0 (more details), 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit

SCOP Domain Sequences for d1hr0n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr0n_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOP Domain Coordinates for d1hr0n_:

Click to download the PDB-style file with coordinates for d1hr0n_.
(The format of our PDB-style files is described here.)

Timeline for d1hr0n_: