SCOP 1.71: Domain d1fjgn_: 1fjg N:

Lineage for d1fjgn_ (1fjg N:)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (14 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (1 species)

7. Species Thermus thermophilus [TaxId:274] [57754] (18 PDB entries)

8. Domain d1fjgn_: 1fjg N: [45154]
   Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_
   complexed with mg, par, scm, sry, zn

Details for d1fjgn_

PDB Entry: 1fjg, 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin

SCOP Domain Sequences for d1fjgn_:

Sequence; same for both SEQRES and ATOM records:

>d1fjgn_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d1fjgn_:

• d1fjgn_ first appeared (with stable ids) in SCOP 1.55
  
• d1fjgn_ appears in SCOP 1.69
  
• d1fjgn_ appears in SCOP 1.73
  
• d1fjgn_ appears in the current release, SCOPe 2.08