Lineage for d1fjfn_ (1fjf N:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 90358Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
  4. 90359Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) (S)
  5. 90452Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 90453Protein Ribosomal protein S14 [57753] (1 species)
  7. 90454Species Thermus thermophilus [TaxId:274] [57754] (10 PDB entries)
  8. 90455Domain d1fjfn_: 1fjf N: [45153]
    Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_

Details for d1fjfn_

PDB Entry: 1fjf (more details), 3.05 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit

SCOP Domain Sequences for d1fjfn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjfn_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOP Domain Coordinates for d1fjfn_:

Click to download the PDB-style file with coordinates for d1fjfn_.
(The format of our PDB-style files is described here.)

Timeline for d1fjfn_: