Lineage for d1latb_ (1lat B:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41378Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
  4. 41379Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) (S)
  5. 41393Family g.39.1.2: Nuclear receptor [57721] (7 proteins)
  6. 41401Protein Glucocorticoid receptor DNA-binding domain [57730] (1 species)
  7. 41402Species Rat (Rattus norvegicus) [TaxId:10116] [57731] (5 PDB entries)
  8. 41404Domain d1latb_: 1lat B: [45123]

Details for d1latb_

PDB Entry: 1lat (more details), 1.9 Å

PDB Description: glucocorticoid receptor mutant/dna complex

SCOP Domain Sequences for d1latb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1latb_ g.39.1.2 (B:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus)}
arpclvcsdeasgchygvltcegckaffkravegqhnylckyegkciidkirrkncpacr
yrkclqagmnlear

SCOP Domain Coordinates for d1latb_:

Click to download the PDB-style file with coordinates for d1latb_.
(The format of our PDB-style files is described here.)

Timeline for d1latb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1lata_