Lineage for d1gnf__ (1gnf -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41378Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
  4. 41379Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) (S)
  5. 41380Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (1 protein)
  6. 41381Protein Erythroid transcription factor GATA-1 [57718] (2 species)
  7. 41391Species Mouse (Mus musculus) [TaxId:10090] [57720] (1 PDB entry)
  8. 41392Domain d1gnf__: 1gnf - [45107]

Details for d1gnf__

PDB Entry: 1gnf (more details)

PDB Description: solution structure of the n-terminal zinc finger of murine gata-1, nmr, 25 structures

SCOP Domain Sequences for d1gnf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gnf__ g.39.1.1 (-) Erythroid transcription factor GATA-1 {Mouse (Mus musculus)}
gsearecvncgatatplwrrdrtghylcnacglyhkmngqnrplir

SCOP Domain Coordinates for d1gnf__:

Click to download the PDB-style file with coordinates for d1gnf__.
(The format of our PDB-style files is described here.)

Timeline for d1gnf__: