SCOPe 2.06: Domain d1e8ra1: 1e8r A:21-69

Lineage for d1e8ra1 (1e8r A:21-69)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.29: Type X cellulose binding domain, CBDX [57614] (1 superfamily)
   disulfide-rich, alpha+beta

4. Superfamily g.29.1: Type X cellulose binding domain, CBDX [57615] (1 family)

5. Family g.29.1.1: Type X cellulose binding domain, CBDX [57616] (1 protein)

6. Protein Endo-1;4-beta-xylanase A CBDX [57617] (2 species)

7. Species Pseudomonas fluorescens, subsp. cellulosa [TaxId:294] [57618] (2 PDB entries)

8. Domain d1e8ra1: 1e8r A:21-69 [44960]
   Other proteins in same PDB: d1e8ra2

Details for d1e8ra1

PDB Entry: 1e8r

PDB Description: solution structure of type x cbd

PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d1e8ra1:

Sequence; same for both SEQRES and ATOM records:

>d1e8ra1 g.29.1.1 (A:21-69) Endo-1;4-beta-xylanase A CBDX {Pseudomonas fluorescens, subsp. cellulosa [TaxId: 294]}
gnqqcnwygtlyplcvtttngwgwedqrsciarstcaaqpapfgivgsg

Timeline for d1e8ra1:

• d1e8ra1 first appeared (with stable ids) in SCOP 1.55, called d1e8ra_
  
• d1e8ra1 was called d1e8ra_ in SCOPe 2.05
  
• d1e8ra1 appears in SCOPe 2.07
  
• d1e8ra1 appears in the current release, SCOPe 2.08