Lineage for d1tpg_2 (1tpg 1-50)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41114Fold g.27: Fibronectin type I module [57602] (1 superfamily)
  4. 41115Superfamily g.27.1: Fibronectin type I module [57603] (1 family) (S)
  5. 41116Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
  6. 41126Protein Tissue-type plasminogen activator, t-PA [57607] (1 species)
  7. 41127Species Human (Homo sapiens) [TaxId:9606] [57608] (3 PDB entries)
  8. 41128Domain d1tpg_2: 1tpg 1-50 [44955]
    Other proteins in same PDB: d1tpg_1

Details for d1tpg_2

PDB Entry: 1tpg (more details)

PDB Description: f1-g module pair residues 1-91 (c83s) of tissue-type plasminogen activator (t-pa) (nmr, 298k, ph2.95, representative structure)

SCOP Domain Sequences for d1tpg_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tpg_2 g.27.1.1 (1-50) Tissue-type plasminogen activator, t-PA {Human (Homo sapiens)}
syqvicrdektqmiyqqhqswlrpvlrsnrveycwcnsgraqchsvpvks

SCOP Domain Coordinates for d1tpg_2:

Click to download the PDB-style file with coordinates for d1tpg_2.
(The format of our PDB-style files is described here.)

Timeline for d1tpg_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tpg_1