Lineage for d1d0gr2 (1d0g R:62-101)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41049Fold g.24: TNF receptor-like [57585] (1 superfamily)
  4. 41050Superfamily g.24.1: TNF receptor-like [57586] (1 family) (S)
  5. 41051Family g.24.1.1: TNF receptor-like [57587] (2 proteins)
  6. 41052Protein Death receptor-5 (dr5) fragment [57590] (1 species)
  7. 41053Species Human (Homo sapiens) [TaxId:9606] [57591] (3 PDB entries)
  8. 41058Domain d1d0gr2: 1d0g R:62-101 [44919]
    Other proteins in same PDB: d1d0ga_, d1d0gb_, d1d0gd_

Details for d1d0gr2

PDB Entry: 1d0g (more details), 2.4 Å

PDB Description: crystal structure of death receptor 5 (dr5) bound to apo2l/trail

SCOP Domain Sequences for d1d0gr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0gr2 g.24.1.1 (R:62-101) Death receptor-5 (dr5) fragment {Human (Homo sapiens)}
rctrcdsgevelspctttrntvcqceegtfreedspemcr

SCOP Domain Coordinates for d1d0gr2:

Click to download the PDB-style file with coordinates for d1d0gr2.
(The format of our PDB-style files is described here.)

Timeline for d1d0gr2: