Lineage for d1d0gr1 (1d0g R:21-61)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 623818Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 623819Superfamily g.24.1: TNF receptor-like [57586] (2 families) (S)
  5. 623820Family g.24.1.1: TNF receptor-like [57587] (4 proteins)
    Pfam 00020; TNFR/NGFR cysteine-rich region
  6. 623825Protein Death receptor-5 (dr5) fragment [57590] (1 species)
  7. 623826Species Human (Homo sapiens) [TaxId:9606] [57591] (3 PDB entries)
  8. 623830Domain d1d0gr1: 1d0g R:21-61 [44918]
    Other proteins in same PDB: d1d0ga_, d1d0gb_, d1d0gd_

Details for d1d0gr1

PDB Entry: 1d0g (more details), 2.4 Å

PDB Description: crystal structure of death receptor 5 (dr5) bound to apo2l/trail

SCOP Domain Sequences for d1d0gr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0gr1 g.24.1.1 (R:21-61) Death receptor-5 (dr5) fragment {Human (Homo sapiens)}
sspseglcppghhisedgrdcisckygqdysthwndllfcl

SCOP Domain Coordinates for d1d0gr1:

Click to download the PDB-style file with coordinates for d1d0gr1.
(The format of our PDB-style files is described here.)

Timeline for d1d0gr1: