Lineage for d1d0gr1 (1d0g R:21-61)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144375Fold g.24: TNF receptor-like [57585] (1 superfamily)
  4. 144376Superfamily g.24.1: TNF receptor-like [57586] (1 family) (S)
  5. 144377Family g.24.1.1: TNF receptor-like [57587] (3 proteins)
  6. 144382Protein Death receptor-5 (dr5) fragment [57590] (1 species)
  7. 144383Species Human (Homo sapiens) [TaxId:9606] [57591] (3 PDB entries)
  8. 144387Domain d1d0gr1: 1d0g R:21-61 [44918]
    Other proteins in same PDB: d1d0ga_, d1d0gb_, d1d0gd_

Details for d1d0gr1

PDB Entry: 1d0g (more details), 2.4 Å

PDB Description: crystal structure of death receptor 5 (dr5) bound to apo2l/trail

SCOP Domain Sequences for d1d0gr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0gr1 g.24.1.1 (R:21-61) Death receptor-5 (dr5) fragment {Human (Homo sapiens)}
sspseglcppghhisedgrdcisckygqdysthwndllfcl

SCOP Domain Coordinates for d1d0gr1:

Click to download the PDB-style file with coordinates for d1d0gr1.
(The format of our PDB-style files is described here.)

Timeline for d1d0gr1: