SCOP 1.73: Domain d1tnrr1: 1tnr R:15-71

Lineage for d1tnrr1 (1tnr R:15-71)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.24: TNF receptor-like [57585] (1 superfamily)
   duplication: consists of three similar disulfide-rich domains

4. Superfamily g.24.1: TNF receptor-like [57586] (2 families)

5. Family g.24.1.1: TNF receptor-like [57587] (5 proteins)
   Pfam PF00020; TNFR/NGFR cysteine-rich region

6. Protein Tumor necrosis factor (TNF) receptor [57588] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57589] (4 PDB entries)

8. Domain d1tnrr1: 1tnr R:15-71 [44912]
   Other proteins in same PDB: d1tnra_

Details for d1tnrr1

PDB Entry: 1tnr, 2.85 Å

PDB Description: crystal structure of the soluble human 55 kd tnf receptor-human tnf- beta complex: implications for tnf receptor activation

PDB Compounds: (R:) tumor necrosis factor receptor p55

SCOP Domain Sequences for d1tnrr1:

Sequence; same for both SEQRES and ATOM records:

>d1tnrr1 g.24.1.1 (R:15-71) Tumor necrosis factor (TNF) receptor {Human (Homo sapiens) [TaxId: 9606]}
cpqgkyihpqnnsicctkchkgtylyndcpgpgqdtdcrecesgsftasenhlrhcl

Timeline for d1tnrr1:

• d1tnrr1 first appeared (with stable ids) in SCOP 1.55
  
• d1tnrr1 appears in SCOP 1.71
  
• d1tnrr1 appears in SCOP 1.75
  
• d1tnrr1 appears in the current release, SCOPe 2.08