Lineage for d1extb2 (1ext B:72-115)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 891719Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 891720Superfamily g.24.1: TNF receptor-like [57586] (2 families) (S)
  5. 891721Family g.24.1.1: TNF receptor-like [57587] (5 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 891785Protein Tumor necrosis factor (TNF) receptor [57588] (1 species)
  7. 891786Species Human (Homo sapiens) [TaxId:9606] [57589] (4 PDB entries)
  8. 891791Domain d1extb2: 1ext B:72-115 [44904]

Details for d1extb2

PDB Entry: 1ext (more details), 1.85 Å

PDB Description: extracellular domain of the 55kda tumor necrosis factor receptor. crystallized at ph3.7 in p 21 21 21.
PDB Compounds: (B:) tumor necrosis factor receptor

SCOP Domain Sequences for d1extb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1extb2 g.24.1.1 (B:72-115) Tumor necrosis factor (TNF) receptor {Human (Homo sapiens) [TaxId: 9606]}
scskcrkemgqveissctvdrdtvcgcrknqyrhywsenlfqcf

SCOP Domain Coordinates for d1extb2:

Click to download the PDB-style file with coordinates for d1extb2.
(The format of our PDB-style files is described here.)

Timeline for d1extb2: