Lineage for d1apj__ (1apj -)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 429461Fold g.23: TB module/8-cys domain [57580] (1 superfamily)
    disulfide-rich; alpha+beta
  4. 429462Superfamily g.23.1: TB module/8-cys domain [57581] (1 family) (S)
  5. 429463Family g.23.1.1: TB module/8-cys domain [57582] (2 proteins)
    transforming growth factor beta binding protein-like domain
  6. 429464Protein Fibrillin [57583] (1 species)
  7. 429465Species Human (Homo sapiens) [TaxId:9606] [57584] (4 PDB entries)
  8. 429471Domain d1apj__: 1apj - [44899]

Details for d1apj__

PDB Entry: 1apj (more details)

PDB Description: nmr study of the transforming growth factor beta binding protein-like domain (tb module/8-cys domain), nmr, 21 structures

SCOP Domain Sequences for d1apj__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1apj__ g.23.1.1 (-) Fibrillin {Human (Homo sapiens)}
saqdlrmsycyakfeggkcsspksrnhskqecccalkgegwgdpcelcptepdeafrqic
pygsgiivgpddsa

SCOP Domain Coordinates for d1apj__:

Click to download the PDB-style file with coordinates for d1apj__.
(The format of our PDB-style files is described here.)

Timeline for d1apj__: