Lineage for d1apja_ (1apj A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034636Fold g.23: TB module/8-cys domain [57580] (1 superfamily)
    disulfide-rich; alpha+beta
  4. 3034637Superfamily g.23.1: TB module/8-cys domain [57581] (1 family) (S)
  5. 3034638Family g.23.1.1: TB module/8-cys domain [57582] (2 proteins)
    transforming growth factor beta binding protein-like domain
  6. 3034639Protein Fibrillin [57583] (1 species)
  7. 3034640Species Human (Homo sapiens) [TaxId:9606] [57584] (5 PDB entries)
  8. 3034647Domain d1apja_: 1apj A: [44899]

Details for d1apja_

PDB Entry: 1apj (more details)

PDB Description: nmr study of the transforming growth factor beta binding protein-like domain (tb module/8-cys domain), nmr, 21 structures
PDB Compounds: (A:) fibrillin

SCOPe Domain Sequences for d1apja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1apja_ g.23.1.1 (A:) Fibrillin {Human (Homo sapiens) [TaxId: 9606]}
saqdlrmsycyakfeggkcsspksrnhskqecccalkgegwgdpcelcptepdeafrqic
pygsgiivgpddsa

SCOPe Domain Coordinates for d1apja_:

Click to download the PDB-style file with coordinates for d1apja_.
(The format of our PDB-style files is described here.)

Timeline for d1apja_: