SCOPe 2.01: Domain d1mafl_: 1maf L:

Lineage for d1mafl_ (1maf L:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
   disulfide-rich; nearly all-beta

4. Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families)

5. Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)

6. Protein Methylamine dehydrogenase [57563] (2 species)

7. Species Paracoccus versutus (Thiobacillus versutus) [TaxId:34007] [57565] (3 PDB entries)

8. Domain d1mafl_: 1maf L: [44888]
   Other proteins in same PDB: d1mafh_
   complexed with hdz

Details for d1mafl_

PDB Entry: 1maf, 2.6 Å

PDB Description: The Active Site Structure of Methylamine Dehydrogenase: Hydrazines Identify C6 as the Reactive Site of the Tryptophan Derived Quinone Cofactor

PDB Compounds: (L:) methylamine dehydrogenase (light subunit)

SCOPe Domain Sequences for d1mafl_:

Sequence; same for both SEQRES and ATOM records:

>d1mafl_ g.21.1.1 (L:) Methylamine dehydrogenase {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]}
vdprakwqpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgka

Timeline for d1mafl_:

• d1mafl_ first appeared (with stable ids) in SCOP 1.55
  
• d1mafl_ appears in SCOP 1.75
  
• d1mafl_ appears in SCOPe 2.02
  
• d1mafl_ appears in the current release, SCOPe 2.08