Lineage for d1kst__ (1kst -)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 204292Fold g.20: Blood coagulation inhibitor (disintegrin) [57551] (1 superfamily)
  4. 204293Superfamily g.20.1: Blood coagulation inhibitor (disintegrin) [57552] (1 family) (S)
  5. 204294Family g.20.1.1: Blood coagulation inhibitor (disintegrin) [57553] (3 proteins)
  6. 204301Protein Kistrin [57558] (1 species)
  7. 204302Species Agkistrodon rhodostoma [TaxId:8717] [57559] (1 PDB entry)
  8. 204303Domain d1kst__: 1kst - [44881]

Details for d1kst__

PDB Entry: 1kst (more details)

PDB Description: solution structure of kistrin, a potent platelet aggregation inhibitor and gp iib-iiia antagonist

SCOP Domain Sequences for d1kst__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kst__ g.20.1.1 (-) Kistrin {Agkistrodon rhodostoma}
gkecdcsspenpccdaatcklrpgaqcgeglcceqckfsragkicriprgdmpddrctgq
sadcpryh

SCOP Domain Coordinates for d1kst__:

Click to download the PDB-style file with coordinates for d1kst__.
(The format of our PDB-style files is described here.)

Timeline for d1kst__: