Lineage for d1rooa_ (1roo A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034336Fold g.19: Crisp domain-like [57545] (1 superfamily)
    disulfide-rich all-alpha fold
  4. 3034337Superfamily g.19.1: Crisp domain-like [57546] (3 families) (S)
  5. 3034338Family g.19.1.1: Sea anemone toxin k [57547] (1 protein)
  6. 3034339Protein Sea anemone toxin k [57548] (2 species)
  7. 3034342Species Sun anemone (Stichodactyla helianthus), SHK [TaxId:6123] [57550] (3 PDB entries)
  8. 3034343Domain d1rooa_: 1roo A: [44876]

Details for d1rooa_

PDB Entry: 1roo (more details)

PDB Description: nmr solution structure of shk toxin, nmr, 20 structures
PDB Compounds: (A:) shk toxin

SCOPe Domain Sequences for d1rooa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rooa_ g.19.1.1 (A:) Sea anemone toxin k {Sun anemone (Stichodactyla helianthus), SHK [TaxId: 6123]}
rscidtipksrctafqckhsmkyrlsfcrktcgtc

SCOPe Domain Coordinates for d1rooa_:

Click to download the PDB-style file with coordinates for d1rooa_.
(The format of our PDB-style files is described here.)

Timeline for d1rooa_: