SCOP 1.71: Domain d1hd4a_: 1hd4 A:

Lineage for d1hd4a_ (1hd4 A:)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families)

5. Family g.17.1.4: Gonadodropin/Follitropin [57528] (3 proteins)

6. Protein Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) [63395] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63397] (7 PDB entries)

8. Domain d1hd4a_: 1hd4 A: [44816]
   complexed with gal, man, nag

Details for d1hd4a_

PDB Entry: 1hd4

PDB Description: solution structure of the a-subunit of human chorionic gonadotropin [modeled with diantennary glycan at asn78]

SCOP Domain Sequences for d1hd4a_:

Sequence; same for both SEQRES and ATOM records:

>d1hd4a_ g.17.1.4 (A:) Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) {Human (Homo sapiens)}
apdvqdcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestcc
vaksynrvtvmggfkvenhtachcstcyyhks

Timeline for d1hd4a_:

• d1hd4a_ first appeared (with stable ids) in SCOP 1.55
  
• d1hd4a_ appears in SCOP 1.69
  
• d1hd4a_ appears in SCOP 1.73
  
• d1hd4a_ appears in the current release, SCOPe 2.08