Lineage for d1dz7a_ (1dz7 A:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 623356Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 623357Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 623490Family g.17.1.4: Gonadodropin/Follitropin [57528] (3 proteins)
  6. 623495Protein Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) [63395] (1 species)
  7. 623496Species Human (Homo sapiens) [TaxId:9606] [63397] (7 PDB entries)
  8. 623502Domain d1dz7a_: 1dz7 A: [44815]

Details for d1dz7a_

PDB Entry: 1dz7 (more details)

PDB Description: solution structure of the a-subunit of human chorionic gonadotropin [modeled without carbohydrate residues]

SCOP Domain Sequences for d1dz7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dz7a_ g.17.1.4 (A:) Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) {Human (Homo sapiens)}
apdvqdcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestcc
vaksynrvtvmggfkvenhtachcstcyyhks

SCOP Domain Coordinates for d1dz7a_:

Click to download the PDB-style file with coordinates for d1dz7a_.
(The format of our PDB-style files is described here.)

Timeline for d1dz7a_: