Lineage for d1dz7a_ (1dz7 A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40812Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
  4. 40813Superfamily g.17.1: Cystine-knot cytokines [57501] (5 families) (S)
  5. 40901Family g.17.1.4: Gonadotropin, A and B chains [57528] (1 protein)
  6. 40902Protein Gonadotropin, A and B chains [57529] (1 species)
  7. 40903Species Human (Homo sapiens) [TaxId:9606] [57530] (5 PDB entries)
  8. 40910Domain d1dz7a_: 1dz7 A: [44815]

Details for d1dz7a_

PDB Entry: 1dz7 (more details)

PDB Description: solution structure of the a-subunit of human chorionic gonadotropin [modeled without carbohydrate residues]

SCOP Domain Sequences for d1dz7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dz7a_ g.17.1.4 (A:) Gonadotropin, A and B chains {Human (Homo sapiens)}
apdvqdcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestcc
vaksynrvtvmggfkvenhtachcstcyyhks

SCOP Domain Coordinates for d1dz7a_:

Click to download the PDB-style file with coordinates for d1dz7a_.
(The format of our PDB-style files is described here.)

Timeline for d1dz7a_: