Lineage for d1qfwa_ (1qfw A:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 522937Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 522938Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 523066Family g.17.1.4: Gonadodropin/Follitropin [57528] (3 proteins)
  6. 523071Protein Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) [63395] (1 species)
  7. 523072Species Human (Homo sapiens) [TaxId:9606] [63397] (7 PDB entries)
  8. 523077Domain d1qfwa_: 1qfw A: [44813]
    Other proteins in same PDB: d1qfwb_, d1qfwh_, d1qfwi_, d1qfwl_, d1qfwm_

Details for d1qfwa_

PDB Entry: 1qfw (more details), 3.5 Å

PDB Description: ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti beta subunit

SCOP Domain Sequences for d1qfwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfwa_ g.17.1.4 (A:) Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) {Human (Homo sapiens)}
dcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestccvaksy
nrvtvmggfkvenhtachcstcyyhks

SCOP Domain Coordinates for d1qfwa_:

Click to download the PDB-style file with coordinates for d1qfwa_.
(The format of our PDB-style files is described here.)

Timeline for d1qfwa_: