Lineage for d1hrpb_ (1hrp B:)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) Superfamily g.17.1: Cystine-knot cytokines [57501] (5 families) 
Family g.17.1.4: Gonadotropin, A and B chains [57528] (1 protein) Protein Gonadotropin, A and B chains [57529] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57530] (5 PDB entries) 
Domain d1hrpb_: 1hrp B: [44812]
Details for d1hrpb_
PDB Entry: 1hrp (more details), 3 Å
PDB Description: crystal structure of human chorionic gonadotropin
SCOP Domain Sequences for d1hrpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hrpb_ g.17.1.4 (B:) Gonadotropin, A and B chains {Human (Homo sapiens)}
keplrprcrpinatlavekegcpvcitvntticagycptmtrvlqgvlpalpqvvcnyrd
vrfesirlpgcprgvnpvvsyavalscqcalcrrsttdcggpkdhpltcd
SCOP Domain Coordinates for d1hrpb_:
Click to download the PDB-style file with coordinates for d1hrpb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hrpb_:
- d1hrpb_ appears in SCOP 1.57
- d1hrpb_ appears in the current release, SCOPe 2.08
View in 3D
