SCOPe 2.07: Domain d1hcnb_: 1hcn B:

Lineage for d1hcnb_ (1hcn B:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.4: Gonadodropin/Follitropin [57528] (4 proteins)

6. Protein Gonadotropin B chain [63396] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63398] (3 PDB entries)

8. Domain d1hcnb_: 1hcn B: [44810]
   Other proteins in same PDB: d1hcna_
   complexed with nag

Details for d1hcnb_

PDB Entry: 1hcn, 2.6 Å

PDB Description: structure of human chorionic gonadotropin at 2.6 angstroms resolution from mad analysis of the selenomethionyl protein

PDB Compounds: (B:) human chorionic gonadotropin

SCOPe Domain Sequences for d1hcnb_:

Sequence; same for both SEQRES and ATOM records:

>d1hcnb_ g.17.1.4 (B:) Gonadotropin B chain {Human (Homo sapiens) [TaxId: 9606]}
keplrprcrpinatlavekegcpvcitvntticagycptmtrvlqgvlpalpqvvcnyrd
vrfesirlpgcprgvnpvvsyavalscqcalcrrsttdcggpkdhpltcd

Timeline for d1hcnb_:

• d1hcnb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hcnb_ appears in SCOPe 2.06
  
• d1hcnb_ appears in the current release, SCOPe 2.08