Lineage for d1hcna_ (1hcn A:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 623356Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 623357Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 623490Family g.17.1.4: Gonadodropin/Follitropin [57528] (3 proteins)
  6. 623495Protein Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) [63395] (1 species)
  7. 623496Species Human (Homo sapiens) [TaxId:9606] [63397] (7 PDB entries)
  8. 623497Domain d1hcna_: 1hcn A: [44809]
    Other proteins in same PDB: d1hcnb_
    complexed with nag

Details for d1hcna_

PDB Entry: 1hcn (more details), 2.6 Å

PDB Description: structure of human chorionic gonadotropin at 2.6 angstroms resolution from mad analysis of the selenomethionyl protein

SCOP Domain Sequences for d1hcna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcna_ g.17.1.4 (A:) Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) {Human (Homo sapiens)}
qdcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestccvaks
ynrvtvmggfkvenhtachcstcyy

SCOP Domain Coordinates for d1hcna_:

Click to download the PDB-style file with coordinates for d1hcna_.
(The format of our PDB-style files is described here.)

Timeline for d1hcna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hcnb_