Lineage for d1wwwv_ (1www V:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2584898Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2584899Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2585103Family g.17.1.3: Neurotrophin [57520] (5 proteins)
    automatically mapped to Pfam PF00243
  6. 2585104Protein beta-Nerve growth factor [57525] (2 species)
  7. 2585105Species Human (Homo sapiens) [TaxId:9606] [57527] (5 PDB entries)
    Uniprot P01138
  8. 2585106Domain d1wwwv_: 1www V: [44807]
    Other proteins in same PDB: d1wwwx_, d1wwwy_

Details for d1wwwv_

PDB Entry: 1www (more details), 2.2 Å

PDB Description: ngf in complex with domain 5 of the trka receptor
PDB Compounds: (V:) protein (nerve growth factor)

SCOPe Domain Sequences for d1wwwv_:

Sequence, based on SEQRES records: (download)

>d1wwwv_ g.17.1.3 (V:) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
sshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdp
npvdsgcrgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrk

Sequence, based on observed residues (ATOM records): (download)

>d1wwwv_ g.17.1.3 (V:) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
sshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdg
crgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrk

SCOPe Domain Coordinates for d1wwwv_:

Click to download the PDB-style file with coordinates for d1wwwv_.
(The format of our PDB-style files is described here.)

Timeline for d1wwwv_: