SCOPe 2.08: Domain d1sgfb_: 1sgf B:

Lineage for d1sgfb_ (1sgf B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.3: Neurotrophin [57520] (5 proteins)
   automatically mapped to Pfam PF00243

6. Protein beta-Nerve growth factor [57525] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [57526] (4 PDB entries)

8. Domain d1sgfb_: 1sgf B: [44805]
   Other proteins in same PDB: d1sgfa_, d1sgfg_, d1sgfx_, d1sgfz_
   complexed with nag, zn

Details for d1sgfb_

PDB Entry: 1sgf, 3.15 Å

PDB Description: crystal structure of 7s ngf: a complex of nerve growth factor with four binding proteins (serine proteinases)

PDB Compounds: (B:) nerve growth factor

SCOPe Domain Sequences for d1sgfb_:

Sequence; same for both SEQRES and ATOM records:

>d1sgfb_ g.17.1.3 (B:) beta-Nerve growth factor {Mouse (Mus musculus) [TaxId: 10090]}
gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr
gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkatr

Timeline for d1sgfb_:

• d1sgfb_ first appeared (with stable ids) in SCOP 1.55
  
• d1sgfb_ appears in SCOPe 2.07