Lineage for d1bndb_ (1bnd B:)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) Superfamily g.17.1: Cystine-knot cytokines [57501] (5 families) 
Family g.17.1.3: Neurotrophin [57520] (3 proteins) Protein Brain-derived neurotrophic factor/neurotrophin 3 heterodimer, BDNF/NT3 [57521] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57522] (3 PDB entries) 
Domain d1bndb_: 1bnd B: [44794]
Details for d1bndb_
PDB Entry: 1bnd (more details), 2.3 Å
PDB Description: structure of the brain-derived neurotrophic factor(slash)neurotrophin 3 heterodimer
SCOP Domain Sequences for d1bndb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bndb_ g.17.1.3 (B:) Brain-derived neurotrophic factor/neurotrophin 3 heterodimer, BDNF/NT3 {Human (Homo sapiens)}
rgevsvcdseslwvtdkssaidirghqvtvlgeiktqnspvkqyfyetrckearpvkngc
rgiddkhwnsqcktsqtyvraltsennklvgwrwiridtscvcalsrk
SCOP Domain Coordinates for d1bndb_:
Click to download the PDB-style file with coordinates for d1bndb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bndb_:
- d1bndb_ appears in SCOP 1.57
- d1bndb_ appears in the current release, SCOPe 2.08
View in 3D
