Lineage for d1tfga_ (1tfg A:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1461751Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1461752Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1461830Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)
  6. 1461889Protein TGF-beta2 [57510] (1 species)
  7. 1461890Species Human (Homo sapiens) [TaxId:9606] [57511] (2 PDB entries)
  8. 1461892Domain d1tfga_: 1tfg A: [44778]

Details for d1tfga_

PDB Entry: 1tfg (more details), 1.95 Å

PDB Description: an unusual feature revealed by the crystal structure at 2.2 angstroms resolution of human transforming growth factor-beta2
PDB Compounds: (A:) transforming growth factor, beta 2

SCOPe Domain Sequences for d1tfga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfga_ g.17.1.2 (A:) TGF-beta2 {Human (Homo sapiens) [TaxId: 9606]}
aldaaycfrnvqdncclrplyidfkrdlgwkwihepkgynanfcagacpylwssdtqhsr
vlslyntinpeasaspccvsqdlepltilyyigktpkieqlsnmivksckcs

SCOPe Domain Coordinates for d1tfga_:

Click to download the PDB-style file with coordinates for d1tfga_.
(The format of our PDB-style files is described here.)

Timeline for d1tfga_: