Lineage for d2tgi__ (2tgi -)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) Superfamily g.17.1: Cystine-knot cytokines [57501] (5 families) 
Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (6 proteins) Protein TGF-beta2 [57510] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57511] (2 PDB entries) 
Domain d2tgi__: 2tgi - [44777]
Details for d2tgi__
PDB Entry: 2tgi (more details), 1.8 Å
PDB Description: crystal structure of transforming growth factor-beta2: an unusual fold for the superfamily
SCOP Domain Sequences for d2tgi__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tgi__ g.17.1.2 (-) TGF-beta2 {Human (Homo sapiens)}
aldaaycfrnvqdncclrplyidfkrdlgwkwihepkgynanfcagacpylwssdtqhsr
vlslyntinpeasaspccvsqdlepltilyyigktpkieqlsnmivksckcs
SCOP Domain Coordinates for d2tgi__:
Click to download the PDB-style file with coordinates for d2tgi__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2tgi__:
- d2tgi__ appears in SCOP 1.57
- d2tgi__ appears in the current release, SCOPe 2.08, called d2tgia_
View in 3D